HORDB

ID: hor005669
Uniprot ID: P83056
Protein name: Kininogen-1-associated peptide
Gene name: NA
Organism: Bombina variegata (Yellow-bellied toad)
Family: Bradykinin-related peptide family
Source: animal
Expression: Expressed by the skin glands.
Disease: NA
Comments: NA
Taxonomy: Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0090729 toxin activity
GO BP: GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0045986 negative regulation of smooth muscle contraction; GO:0045987 positive regulation of smooth muscle contraction; GO:0050796 regulation of insulin secretion; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: IYNAIWPCKHCNKCKPGLLCKK
Length: 22
Propeptide: MRLWFCLSFLIILCVEHFPGTLAVERNVPESEEKTEQFLRDLFEISRLQRRPAGFTPFRGKFHSQSLRGLSETKRIYNAIWPCKHCNKCKPGLLCKK
Signal peptide: MRLWFCLSFLIILCVEHFPGTLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005669_AF2.pdb

hor005669_ESM.pdb

Mass:	293596	Formula:	C115H186N32O26S4
Absent amino acids:	DEFMQRSTV	Common amino acids:	K
pI:	9.52	Basic residues:	6
Polar residues:	8	Hydrophobic residues:	6
Hydrophobicity:	-32.27	Boman Index:	-1595
Half-Life:	20 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	75.45
Instability Index:	1345.45	Extinction Coefficient cystines:	7240
Absorbance 280nm:	344.76

PubMed ID: 15134346
Title: Skin secretion of the toad Bombina variegata contains multiple insulin-releasing peptides including bombesin and entirely novel insulinotropic structures.